PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678372187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family DBB
Protein Properties Length: 218aa    MW: 24337.8 Da    PI: 5.3869
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678372187genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.34.7e-06442537
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                C+ + ++e+   C  ++  lC++C ++ H        H
  678372187  4 LCDVCTREEAAVLCIADEAVLCASCDSTVHCAnklagkH 42
               7***************************99554556666 PP

2zf-B_box29.91.1e-095587335
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                ++C+ ++ek++ lfC+++++ lC+ C ++ H+
  678372187 55 SPICDICKEKRALLFCQEDRTILCRGCDSQMHQ 87
               689**************************9994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.139147IPR000315B-box-type zinc finger
CDDcd000216.46E-4347No hitNo description
SMARTSM003367.6E-4447IPR000315B-box-type zinc finger
SMARTSM003364.9E-1553100IPR000315B-box-type zinc finger
PROSITE profilePS5011910.33853100IPR000315B-box-type zinc finger
PfamPF006432.5E-85595IPR000315B-box-type zinc finger
CDDcd000211.98E-856100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MKILCDVCTR EEAAVLCIAD EAVLCASCDS TVHCANKLAG KHSRLALRRP PSGKSPICDI  60
CKEKRALLFC QEDRTILCRG CDSQMHQVNE LTRKHARFLL TGVGIETSPE LVATQKRKRS  120
PPPATVSTSS ISEYFINTLP GWRVDDFLES SSYQSSKVAE EGDKEPFWGF DLIPTENQNQ  180
IQIQIPEMTG LDQKWMESEE NLFTVPEILP PSSRGAFC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LQZ72e-50BBX21_ARATH; B-box zinc finger protein 21
STRINGVIT_18s0001g13520.t019e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14632364
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.12e-51salt tolerance homolog2